About Products Protein Database Contact

Protein expression services for GM2A | Ganglioside GM2 activator

Description
Binds gangliosides and stimulates ganglioside GM2 degradation. It stimulates only the breakdown of ganglioside GM2 and glycolipid GA2 by beta-hexosaminidase A. It extracts single GM2 molecules from membranes and presents them in soluble form to beta-hexosaminidase A for cleavage of N-acetyl-D-galactosamine and conversion to GM3. The large binding pocket can accommodate several single chain phospholipids and fatty acids, GM2A also exhibits some calcium-independent phospholipase activity (By similarity).
Species
Macaca fascicularis
Length
190 amino acids
Sequence
MQSLMQAPVLIALGLLFAAPAQAHLKKLGSFSWDNCDEGKDPAVIRSLTLEPDPILIPGNVTVSVVGSTSVLLSSPLKVELVLEKEVAGLWIKIPCTDYIGSCTFEDFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPHLELPSWLTTGNYRIESILSNRGKRLGCIKIAASLKGV
Mass
20.6 kDa
Simulated SDS-PAGE
Western blot of GM2A recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make GM2A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here