Involved in the degradation of isopropylamine, which is a constituent of the herbicides atrazine. Catalyzes the hydrolysis of gamma-glutamyl-L-alaninol (GALO) to L-alaninol and L-glutamate. It can also uses gamma-glutamyl-isopropylamide, gamma-glutamyl-ethylamide, L-glutamine, and gamma-glutamyl-p-nitroanilide.

295 amino acids

MEKLRILICDGNTEADRASFKKFVGCAPSKQFESLLKNYNSQIRTEIAFPADPGPLMTLPLGAYDGILITGSNSHIYEAQPGNLRQIEFAQKAFASGTPMFGVCWGMQLAVVAAGGEVLPSRVADCSCETPFATGVELTSYGSGHPMHHSRTSGFDVFSFHSDEVTRLPGGAVVTARNRNFIQAVEIKHGRSTFWGVQYHPELSGWDQAGFLRESARSLVEDGSYETLNHVEHAAQAISMFKAGAQISEENLVHFEGVDTNSFEFRPLEILNWLDHLVIPTAKRKFGWGGGWLQK

32.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ipuF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here