Catalyzes the NADPH-dependent reduction of L-glutamate 5-phosphate into L-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes cyclization to form 1-pyrroline-5-carboxylate.

Belongs to the gamma-glutamyl phosphate reductase family.

420 amino acids

MDGTDVTMLMREIGVRARAAAAELAFAEPSRKEEALNAAAEAMLARSDEILEANGRDLAFGAEKGLTPAMMDRLKLDAARIDGIVEGLRAVAGQPDPVGQVIAEWDRPSGLHIRRVRTPLGVVGVIYESRPNVTADAGALCLKSGNAVILRGGSESFHSSGAIHAALQDGLRQAGLPVDAIQRVPTRDRAAVAEMLRMVEHIDVIVPRGGKGLVGLVQAEARVPVFAHLEGICHVYADGEADLEKARRVVLNAKTRRTGICGSAECLLIDRAFLAKHGPVLIEDLLKAGVEVRAEGELAQVPGTVPAQPEDFGREFLDMIIAAKVVDGVDEAIAHIRRYGSSHTESILTENDATAERFFRRLDSAILMRNASTQFADGGEFGMGAEIGIATGKMHARGPVGAEQLTSFKYLVTGDGTIRT

44.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make proA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here