Enzyme involved in the catabolism of H(2)CO(3) but that does not mediates the reversible hydration of carbon dioxide. Mediates complex I assembly in mitochondria and respiration (By similarity).

Belongs to the gamma-class carbonic anhydrase family.

275 amino acids

MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAFVAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVIEFEKVLRKKHALKDEEYDSMLGIVRETPPELNLPNNILPDKETKRPSNVN

30 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GAMMACA1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here