May catalyze alpha-1,3 and alpha-1,4 glycosidic linkages involved in the expression of sialyl Lewis X and Lewis X/SSEA-1 antigens. It may be involved in blood group Lewis determination. Also acts on the corresponding 1,4-galactosyl derivative, forming 1,3-L-fucosyl links.

Belongs to the glycosyltransferase 10 family.

365 amino acids

MYPPGCAKVKCSWHHCLPGLLLQLLLALCFFSYLRMSQEKPKPKPMWVSELGAPSQATEGSSAHLPLRVLLWTWPFNQPVALSRCSELWPGTADCQLTVNRSEYPQADAVLVHHREVSHRPQMQLPPSPRPPGQRWVWFSMESPSNCLKLKDLDGYFNLTMSYRRDSDIFMPYGWLEPWPSQPVETLLNISAKTKLVAWVVSNWNTDSIRVQYYKLLKPHLQVDVYGRFHTPLPHALMAKQLSQYKFYLAFENSLHPDYITEKLWKNALQAWAVPVVLGPSRVNYEQFLPPKAFIHVEDFQSPKDLAQYLLALDKDYASYLNYFRWRETLRPRSFSWALMFCKACWKLQQEPRYQTVPSIASWFQ

42.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FUT3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here