Description
Ran GTPase system comprises ran-1, ran-2 and ran-3 and is essential in nucleocytoplasmic transport. Ran-1 is a GTP-binding protein that mediates the interaction between mitotic chromosomes and kinetochore microtubules. Plays a crucial role in nuclear envelope assembly at the end of each cell division. Required for the import of protein into the nucleus and also for RNA export. RCC1 (ran-3)/Ran (ran-1) complex (together with other proteins) acts as a component of a signal transmission pathway that detects unreplicated DNA.
Family
Belongs to the small GTPase superfamily. Ran family.
Species
Caenorhabditis elegans
Sequence
MSGGDGIPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTARVTYKNVPNWHRDLARVCENIPIVLCGNKVDVKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLLGDPNLEFVAMPALAPPEVQMDPAMIAEYEKDLDNAAKADLPDDDDDL
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service