GTPase that associates with the 50S ribosomal subunit and may have a role during protein synthesis or ribosome biogenesis.

Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily. HflX GTPase family.

423 amino acids

MTELIELKEIEERVILVAVSTGDEEDAKGSLDELEELVKTAGAVAVDKVIQNRERIHPGTYLGKGKIEEIKDRIWELDATGIVCDDELSPAQLRNLEGALDTKVMDRTMVILDIFASRAVTREGKIQVELAQLRYRSARLVGLRSSLSRLGGGIGTRGPGEKKLEMDRRLIHDRIGMLKAELEDVKRHREVVRQQRDKNHVPAAAIVGYTNAGKSTLLNRLTDAGILAEDKLFATLDPTTRNLSLPGGQQILLTDTVGFIRKLPHHLIEAFKSTLEEAKYSDIILHVVDCSNPQMDMQMYVVYETLRELGICDKIMITVFNKIDAADAGVILRDVSSDHQVRISAKTGEGLDELINLLETILRNQKVYLERIYSYKEAGKIQLIRKYGQLLKEEYQEDGIFVNAYVPSELFASLADNADAFNE

47.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hflX using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here