Catalyzes the formation of 2-amino-5-formylamino-6-ribofuranosylamino-4(3H)-pyrimidinone ribonucleotide monophosphate and inorganic phosphate from GTP. Also has an independent pyrophosphate phosphohydrolase activity.

Belongs to the archaeal-type GTP cyclohydrolase family.

255 amino acids

MIQVTLIQIDNYGPWTVTPGPRAEPDLQTLQSRLYGDLEREFGAHGAIVFFNRFDNLIAISNGMDYDDHLLIQQSIRNRYPITISMGVGTADTAYEAQKIATKMIQNGGGAQSANRCEVLNIDSLADDDNSLVQIAHIDINDITNTLTDIETAFDTSIKVYEVLLALMDELAKIGGMCFFIGGDNYMAPTNGISKDQLREALKVVDKKTGVTLKAGIGVAKQAGRAADLADIGLEDIRAELVDDSVLLFNDLDEY

27.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gch3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here