Catalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate.

Belongs to the radical SAM superfamily. MoaA family.

337 amino acids

MQTIPIKHVGNDPLVDAFQRRYYYLRLSITDVCNFRCNYCLPNGYQPESNKPSFLTLNEIRLVVKSFANMGTEKVRITGGEPTLRKDFLPIVETIAQNPTIKQIALTTNGYRMAKDVAAWKEAGITSINVSIDSLDARMFHRITGIDKFEDVMRGLERAFEVGYQKIKVNSVLMRDLNDADFNQFLTWIKDKPIQMRFIELMQTGEMDHFFQQHHVSGQLLADKLINAGWTLQSKGLLDGPAKVFKHPDYVGEVGLIMPYEKNFCASCNRLRVSAKGKLHLCLFGEEGITLRDLLQSDDQQLQLQARISSALQGKREHHFLHQGDSGVRANLASIGG

38.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make moaA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here