Small GTPase required for proper nuclear import of RNA polymerase II and III (RNAPII and RNAPIII). May act at an RNAP assembly step prior to nuclear import.

Belongs to the GPN-loop GTPase family.

276 amino acids

MVKVAAFVCGVASSGKSTFCGALMSYMKSVGRSCHLVNLDPAAENFEWEPTVDIRDLISIDDVMEELDYGPNGGLIYCFEFLMENLDWLNEEIGDYDEDYLIFDMPGQIELYTHVPILPALIRHLQVTLNFRPCAVYLLESQFLVDRTKFFAGVLSAMSAMVMMEVPHINLLSKMDLLKDNNNITKAELKRFLNTDPLLLTGEINETTNPKFHELNRCIVQLIDDFNMVNFLPLESGNEESVSRVLSYIDDATQWYEDQEPKDPDRFEADDLEDDE

31.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fet5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here