Confers resistance to the necrotrophic fungus Alternaria brassicicola. Possesses lipase and antimicrobial activities that directly disrupt fungal spore integrity. Triggers systemic resistance, mostly by the ethylene-dependent pathway.

Belongs to the 'GDSL' lipolytic enzyme family.

374 amino acids

MENSQLVSITFLAYTIIISIGSINCIDNNNLVTNQSALFVFGDSVFDAGNNNYIDTLSSVRSNYWPYGQTTFKSPTGRVSDGRLIPDFIAEYAWLPLIPPNLQPFNGNSQFAYGVNFASGGAGALVGTFSGLVINLRTQLNNFKKVEEMLRSKLGDAEGKRVISRAVYLFHIGLNDYQYPFTTNSSLFQSISNEKYVDYVVGNMTDVFKEVYNLGGRKFGILNTGPYDCAPASLVIDQTKIRSCFQPVTELINMHNEKLLNGLRRLNHELSGFKYALHDYHTSLSERMNDPSKYGFKEGKKACCGSGPLRGINTCGGRMGLSQSYELCENVTDYLFFDPFHLTEKANRQIAELIWSGPTNITGPYNLKALFELN

41.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GLIP1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here