Protein expression services for GONST1 | GDP-mannose transporter GONST1
Description
Involved in the import of GDP-mannose from the cytoplasm into the Golgi lumen (PubMed:11595802, PubMed:20576760, PubMed:27381418). Required for the luminal synthesis of a variety of plant cell surface components (PubMed:11595802). Is required for the correct mannosylation of the glycosylinositol phosphoceramides (GIPC). Can indifferently transport GDP-mannose, GDP-Glucose, GDP-Fucose or GDP-Galactose in vitro (PubMed:23695979, PubMed:27381418).
Family
Belongs to the nucleotide-sugar transporter family. GDP-Mannose:GMP antiporter (GMA) (TC 2.A.7.13) subfamily.
Species
Arabidopsis thaliana
Length
333 amino acids
Sequence
MKLYEHDGVDLEDGKTVKSGGDKPIPRKIHNRALLSGLAYCISSCSMILVNKFVLSSYNFNAGIFLMLYQNFVSVIIVVGLSLMGLITTEPLTLRLMKVWFPVNVIFVGMLITSMFSLKYINVAMVTVLKNVTNVITAVGEMYLFNKQHDNRVWAALFLMIISAVSGGITDLSFNAVGYAWQIANCFLTASYSLTLRKTMDTAKQVTQSGNLNEFSMVLLNNTLSLPLGLLLSYFFNEMDYLYQTPLLRLPSFWMVMTLSGLLGLAISFTSMWFLHQTGATTYSLVGSLNKIPLSIAGIVLFNVPTSLQNSASILFGLVAGVVFARAKMREKS
Mass
36.8 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make GONST1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here