Acts as the major nucleotide-sugar transporter for the import of GDP-Fucose into the Golgi lumen. Transports GDP-Fucose in a strict counter-exchange mode. Is required for proper plant growth and development (PubMed:27381418). Acts also as a GDP-mannose transporter that may be involved in the import of GDP-mannose from the cytoplasm into the Golgi lumen (PubMed:15480787).

Belongs to the nucleotide-sugar transporter family. GDP-Mannose:GMP antiporter (GMA) (TC 2.A.7.13) subfamily.

341 amino acids

MSSSRFDSNKQLTTSSLVIGYALCSSLLAVINKLAITYFNYPGLLTALQYLTCTVAVYLLGKSGLINHDPFTWDTAKKFLPAAIVFYLAIFTNTNLLRHANVDTFIVFRSLTPLLVAIADTVFRSQPLPSRLTFLSLVVILAGAVGYVATDSSFTLTAYSWALAYLVTITTEMVYIKHMVSNIKLNIWGLVLYNNLLSLMIAPVFWFLTGEFTEVFAALSENRGNLFEPYAFSSVAASCVFGFLISYFGFAARNAISATAFTVTGVVNKFLTVVINVLIWDKHATPVGLVCLLFTICGGVGYQQSVKLDKPIEKVSEKDSEKGEEDEELTQLVPGKLASVV

37.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GFT1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here