Required for N-linked oligosaccharide assembly. Has a role in the last step of the synthesis of the Man(5)GlcNAc(2)-PP-dolichol core oligosaccharide on the cytoplasmic face of the endoplasmic reticulum (By similarity).

Belongs to the glycosyltransferase group 1 family.

616 amino acids

MGYLVVIGVIACVAYGILQVVSTVLPRLLLVPSQNWQDKIKKEIEQPMVRYLKVGNKRSSYRRRLVLASKQPSFYTNFVNNKIKVASVDSQNDEGEFLAEMKKRDVRDPQRKIIYGFFHPYANNGGGGERVLWQAVQATLATSDRNIVAIYTTNYESDPTSILDKVEAKFQISRLDEDRIVFVYLRKYARLIDGDYWKRFTLIGQLFGSMVLSWEAMFELSPDVWIDTIGLPGSYLLVSLVLKIPIMSYVHYPIIQPEMFNKLKFQGLSQIRVPKLSEIKTDVFSIGKLIYWSGVFYFYKYLGSLVNITLANGSWTFNHISNIWTINKDEAGYEMDILYPPCGTETLTKNVETLGSRENKLLFIAQFRPEKRHSLILRQYSKFLVNATSIGTPLKNIPTLVFLGSCRTPDDTKTLHDLKQEVDDLELNGYVEFVVDCSYEDIMVWLSKVKFGLNAMWNEHFGIGVVEYMSRGVIPLCHASAGPLLDIVTNWDNEPTSVSWYNNTGFFFKDKSDPDFDLSLQSDTASEFLQFSSRDNKDSTSTYPTLARLLDELFITNPDLISETRLQSMRENGVKSVLEKFSNGVFTLKWMQYSNQLGDLEKSYREERRSGIEKVY

70.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ALG11 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here