Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters (PubMed:22102866, PubMed:25077795). Involved in the modulation of chloroplast development, growth and division in a cytokinin-dependent manner (PubMed:22102866, PubMed:22811435). Repressor of the gibberellic acid (GA) signaling pathway that represses flowering and modulates greening, in a SOC1-dependent manner (PubMed:20844019, PubMed:23739688, PubMed:25077795). Prevents the accumulation of SOC1 during flowering (PubMed:23739688). Promotes chlorophyll biosynthesis throughout the plant, by regulating chlorophyll biosynthetic genes (e.g. HEMA1 and GUN4) and chloroplast localized glutamate synthase (e.g. GLU1) (PubMed:18417639, PubMed:20844019, PubMed:22102866, PubMed:23878229, PubMed:25077795). Involved in the regulation of sugar-sensing genes (e.g. HXK1, HXK2, STP13 and PLT6) (PubMed:18417639). Regulator of germination, senescence, elongation growth and flowering time (PubMed:20844019, PubMed:22102866, PubMed:23878229). Influences also leaf starch content (PubMed:22102866).

Belongs to the type IV zinc-finger family. Class B subfamily.

398 amino acids

MDSNFHYSIDLNEDQNHHEQPFFYPLGSSSSLHHHHHHHHHQVPSNSSSSSSSISSLSSYLPFLINSQEDQHVAYNNTYHADHLHLSQPLKAKMFVANGGSSACDHMVPKKETRLKLTIRKKDHEDQPHPLHQNPTKPDSDSDKWLMSPKMRLIKKTITNNKQLIDQTNNNNHKESDHYPLNHKTNFDEDHHEDLNFKNVLTRKTTAATTENRYNTINENGYSNNNGVIRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQRKARRAAMAAAAAAGDQEVAVAPRVQQLPLKKKLQNKKKRSNGGEKYNHSPPMVAKAKKCKIKEEEEKEMEAETVAGDSEISKSTTSSNSSISSNKFCFDDLTIMLSKSSAYQQVFPQDEKEAAVLLMALSYGMVHG

44.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GATA21 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here