Irreversibly catalyzes the reduction of fumarate to succinate.

Belongs to the FAD-dependent oxidoreductase 2 family. FRD/SDH subfamily.

513 amino acids

MRCLTIYTWTFRRLPFIPSTNSASFFSTLRFNMSTANNTQAIVIGGGLAGLSATNTILDLGGNVLLLDKNTAFGGNSVKAASGINAAPTQLQFDQHVSDSVNTFYNDSILSAKSKAKPELLRTLTSKSSSAVDWLSERFGLQMDQLSRLAGHSEPRTHRGTHPDYPFKPLAFVLVDQTEKFAASHPDRLQIKKNARVTRLLTNPNHDKVFGVEYMDLSDKSNHTVYGPVVLATGGYAADYSDDSLLKLYHPEALSLSTTNGPYCTGDGHKMVMSIGGSTVDLDLVQIHPTGFVDPKDPTALTKFLAAEALRGSGAVLLTSQGRRFCDELGYRDYVTGEMMKLKSPVYLVLNSAAAEEVANFIKFYSFKGLMKKMKAEELCSTLNCTKDELASTFSEYNRAAKGEIPDEFGRKYFGKTPLELTDTFTVGEVVPVLHYTMGGVQVDTQSRVLSTNGNVIDGLFAAGEIVGGIHGENRLGGSSLLACVVFGRLAGQGASSTMLRRFIASSTSTASS

55.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make osm1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here