Seems to be involved in the anchoring of the catalytic components of the fumarate reductase complex to the cytoplasmic membrane.

Belongs to the FrdC family.

127 amino acids

MSNRKPYVREMTRTWWKDHPFYRFYMVREATVLPLIFFTICLLVGLGSLVKGPLAWASWLDFMANPIVVALNIVALAGSLFHAQTFFSMMPQVMPIRLGGKTLDKKVVVLAQWAAVAAITLLVLVIV

14.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make frdC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here