Description
The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated. Energy is transferred from the carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers where it is used to synthesize ATP and reducing power.
Family
Belongs to the fucoxanthin chlorophyll protein family.
Sequence
MKLAIAALLAGSAAAFAPAQSGKASTALNMAFESELGAQPPLGFFDPLGMLADADQERFDRLRYVEVKHGRIAHVAFLGQIVTRNGIHLSGNIDYAGNSFDSFPNGWAAISGPDAIPQAGLLQIVAFVGILELAVMKDVTGEGEFPGDFRNGALDFGWDTFDEETKLSKRAIELNNGRAAMMGILGLMVHEQLGGSIPIVGEM
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service