The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated. Energy is transferred from the carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers where it is used to synthesize ATP and reducing power.

Belongs to the fucoxanthin chlorophyll protein family.

198 amino acids

MKFTVFASLFASAAAFAPAQQAARTSVATNMAFESELGAQAPLGFYDPLGLVADGDQEKFDRLRYVEIKHGRISMLAVAGYLAQEAGWRLGGDIALDGTKFADIPNGFAALSAIPQAGLIQIIAFIGFLETSVMKDITGGEFVGDFRNGYIDFGWDSFDQETKLRKRAIELNQGRAAQMGILALMVHEQLGVNILPGV

21.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FCPB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here