About Products Protein Database Contact

Protein expression services for FCPA | Fucoxanthin-chlorophyll a-c binding protein A, chloroplastic

Description
The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated. Energy is transferred from the carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers where it is used to synthesize ATP and reducing power.
Family
Belongs to the fucoxanthin chlorophyll protein family.
Species
Phaeodactylum tricornutum
Length
196 amino acids
Sequence
MKFAVFASLLASRAAFAPAQQSARTSVATNMAFENEIGAQQPLGYWDPLGLVADGNQEKFDRLRYVEIKHGRICMLAVAGYLTQEAGIRLPGDIDYSGTSFESIPNGFAALSAVPGAGIAQIIAFIGFFEIAVMKDITGGEFVGDFRNNYLDFGWDTFSEDKKLQKRAIELNQGRAAQMGILALMVHEQLGVSILP
Mass
21.3 kDa
Simulated SDS-PAGE
Western blot of FCPA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make FCPA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here