Description
Involved in the interconversion between alpha- and beta-L-fucoses. L-Fucose (6-deoxy-L-galactose) exists as alpha-L-fucose (29.5%) and beta-L-fucose (70.5%), the beta-form is metabolized through the salvage pathway. GDP-L-fucose formed either by the de novo or salvage pathways is transported into the endoplasmic reticulum, where it serves as a substrate for N- and O-glycosylations by fucosyltransferases. Fucosylated structures expressed on cell surfaces or secreted in biological fluids are believed to play a critical role in cell-cell adhesion and recognition processes (By similarity).
Family
Belongs to the RbsD / FucU family.
Sequence
MVVLKGVPALLSPELLFALARMGHGDEIVLADVNFPSSSICRGGPEEIRADGLGIPQLLEAVLQLLPLDTYVQSPAMVMELVPSDRKSGLLTPVWTSYQSILSRAGYEFSLGMGRFAFYERAKKAFAVVATGETALYGNLILKKGVLAPKDLC
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service