Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Belongs to the fungal hydrophobin family.

109 amino acids

MRFSLAILALPVLAAATAVPRGGASKCNSGPVQCCNTLVDTKDKHQTNIVGALLGLDLGSLTGLAGVNCSPVSVIGVGGNSCSTQTVCCEGTQFNGLVNVGCTPINVGL

10.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SC1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here