Catalyzes the transfer of a formyl group from 5-formyl tetrahydromethanopterin (5-formyl-H(4)MPT) to methanofuran (MFR) so as to produce formylmethanofuran (formyl-MFR) and tetrahydromethanopterin (H(4)MPT).

Belongs to the FTR family.

334 amino acids

MADPAATPKSLSIACVSIKDTFAEAFDMKATRLIVTADDRRWCDESARAMCGFGTSVIACGLEIAVEQTLSPEQTPDGRPGVAILAFGMSGKDLEKQIPRRAGQCVLTCPTTALYGGIPGGREVHPKRVPIGKSLRYFGDGNQISKQIQHLDADGRSRPVRYWRIPVMDGEFVCQHDVGRVDAIGGGNFILVGRTMQSVTIASRAAIDAMRELPGIITPFPGGTTRSGSKVGSKYAALFASTNDSFCPTLREVTPSELPSEANAAIEVVIDGLSFDEIAESMRVGITAACEAGASEGLLSVSAGNYGGKLGRHHFKLHELLADASSASDSGAER

35.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ffsA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here