Involved in the catabolism of oxalate and in the adapatation to low pH via the induction of the oxalate-dependent acid tolerance response (ATR). Catalyzes the transfer of the CoA moiety from formyl-CoA to oxalate (By similarity).

Belongs to the CoA-transferase III family. Frc subfamily.

424 amino acids

MAKALNGVRILDFTHVQSGPTCTQLLAWFGADVIKVERPGTGDITRGQLQDVPNADSLYFTMLNHNKRSITLDAKNPKGKEVLTALIKSCDVMVENFAPGVLDRMGFSWENIQKINPKLIVASIKGFGPGPFEDCKVYENVAQCTGGSASTTGFRDGLPLVTGAQIGDSGTGLHLALGIVTALFHRTHSGKGQRVTVAMQDSVLNLCRVKMRDQQRLAHGPLKEYSQFGEGIPFGDATPRAGNDSGGGQPGRILKCKGWETDPNAYIYFITQAAVWEKICDVIGEPTWKTDPNYAKPGARLPRLNEIFGRIEQWTMTKTKFEVMNICNPFDIPCGPILSMKEIAEDKSLYATGTLVEVDHPTRGKYISVGNPIKLSDSPADVRRSPLLGEHTDEILRDVLKFSESQVSDIRSSGALGEVPLAAE

46.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make frc using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here