May have an olfactory function associated with the identification of pathogens or of pathogenic states.

Belongs to the G-protein coupled receptor 1 family.

339 amino acids

MEANFSIPQNGSEVVFYDSTTSRVICIFLVVVLSITFLLGVIGNGLVIYVAGFRMTHTVTTICYLNLALSDFSYMASLPFQITSIVMNGEWLFGWFLCKFVHMIINVNLFLSIFLITFIAMDRCICVLHPVWAQNHRTVNVATKVIFGAWILVLMLIFPHCIFVTTVKDESGKVHCICNFESWAATPEEQVKVSMTVSLISVTISFIIGFSIPMIFIVICYGLMAAKIGRRGFVNSSRPLRVLTAVAISFFVCWFPFQLIFLLGNIGNKETQNNIDTWVNTASTLASFNSCLNPILYVFLGQQFRERLIYSLSASLERALREDSALNSDKTRNLSSQRL

38.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Fpr-rs6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here