Catalyzes the NAD(+)-dependent oxidation of formate to carbon dioxide. Formate oxidation is the final step in the methanol oxidation pathway in methylotrophic microorganisms. Has a role in the detoxification of exogenous formate in non-methylotrophic organisms.

Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. FDH subfamily.

365 amino acids

MGKVLMVLYDGGSHAKDQPGLLGTTENELGIRKWIEEQGHTLVTTSDKDGENSTFDKELVDAEVIITTPFHPGYLTAERLAKAKNLKLAVTAGIGSDHVDLDAANKTNGGITVAEVTGSNVVSVAEHVVMTILLLVRNFVPAHDQIRNGDWNVAAVAKNEFDLENKVVGTVGVGRIGERVLRRLKPFDCKELLYYDYQPLRPEVEKEIGARRVDSLEEMVSQCDVVTINCPLHEKTRGLFNKELISKMKPGSWLVNTARGAIVVKEDVAEALKSGHLRGYGGDVWFPQPAPKEHPLRYAEHPWGGGNATVPHMSGTSIDAQIRYANGTKAILDSYFSGRFDYQPQDLIVHGGDYATKAYGQREKK

40.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make aciA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here