Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized purines, such as 7,8-dihydro-8-oxoguanine (8-oxoG). Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates.

Belongs to the FPG family.

289 amino acids

MPELPEVEVVRRGLQSHAVGAAIEAVEVLHPRAIRRHILGSEDLIGQLTGQTIASAERRGKYLWLVLEPAGVGLVVHLGMSGQMLVQPPTVDWEKHLRIRLALDSGADLRFVDQRTFGGWSISPLVEVDGTMLPESVAHIARDPMDAAFDLESVVKVLRGKHTEIKRAILDQTVVSGIGNIYADESLWRAKIHGNRIAESLTRPKLRELLTAAHSVMGEALDQGGTSFDALYVNVNGESGYFDRSLSAYGQENLPCPRCGAPIKREKFMNRSSFSCPRCQPTPRARRIA

31.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mutM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here