About Products Protein Database Contact

Protein expression services for mutM | Formamidopyrimidine-DNA glycosylase

Description
Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized purines, such as 7,8-dihydro-8-oxoguanine (8-oxoG). Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates.
Family
Belongs to the FPG family.
Species
Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778)
Length
273 amino acids
Sequence
MPEMPEVETVRRTLRPLVVGKTIDHVDIWYDKVITGDPETFKRELKGKTFTAVDRYAKFLLFRLGDLTVVSHLRMEGKYHLTTWDAPVDKHEHLQFAFTDGSSLRYADVRKFGRLQLVETGTEFQVTGLKNLGVEANSPEFRLDYFEKGLKKRSMNIKSLLMSQTLVAGLGNIYVDEVLWQSRINPLTPANELTKDQVKQLHSAINETIEEATKYGGTTVHSFLNAEGGAGHYQEKLKVYGKEGQPCPRCGEDFVKIKISGRGTTYCLHCQKR
Mass
31 kDa
Simulated SDS-PAGE
Western blot of mutM recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make mutM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here