Description
Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized purines, such as 7,8-dihydro-8-oxoguanine (8-oxoG). Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates.
Family
Belongs to the FPG family.
Species
Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Sequence
MPEMPEVETVRRTLTPLVKGKTIAKIIIWYPKIIVNNPDEFVEKLTNKKILKIDRYGKYLLFRFSDDLTMVSHLRMEGKYHLVTPDHPKGKHEHVEFVFTDGTALRYADVRKFGRMHLVETGTEKQTTGIRHLGPEPNTEEFSVEYFINALSRKKKNIKNTLLDQTVVCGLGNIYVDEVLWQSKIHPLSSAKSIPADKIVDLYHNINHTITVATKERGTTVHTYLDANGDIGGYQNMLQVYGHAGEECNNCGTILEKIKVNGRGTTFCPHCQVLYK
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service