Transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters. May have a role in the organization of the testicular vasculature.

329 amino acids

MQKQPSPESLAPSAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRFTKRTGAQGTKGPVKIDHRPHRATSPDPGAPKTTTGRLCPFPQEVPNPKGLSFEGLMGSLPANMSSTTSDVRPQLPTGPKEMCSAKSGGPRELSEATSPSPCPAFGFSSAFSDAESLGKAPTPGVAPESVGSSYQCRMQTLNFCMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVAGSFPVQGGSGYPLGLPPCLYRTPGMFFFE

35.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Foxs1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here