Transcription factor. Essential for ventral specification of the early cephalic (head) ectoderm during gastrulation, playing a role in the 'non-neural' versus 'neural' cell fate choice. Binds to DNA via the target sequence 5'-[AG]TAAA[CT]A-3', with 5'-ATAAACA-3' being the preferred binding site.

367 amino acids

MNPVQQPAQHRSPASLLHLPHPKRAQEAPDMGLYCDNFMFSQQNLHPSQRAPNFSIGGEFTPPANPYLWLGGPGMNNAPNYSPAPAPYIPSAFSAPQRHFMANSAAFGGADLGWMSAASQEELLKMVRPPYSYSALIAMAIQNASDKRLTLSQIYQYVAENFPFYKKSKAGWQNSIRHNLSLNDCFKKMPRDENDPGKGNYWTLDSNCEKMFDNGNFRRKRKPKSESNNAKIAKRDEDHLNPKGKESPPMITPSSSPEVLSPTGHSKSPSPPTVTYTPCLTNFIGSMTAVDSATMNRQSPLGLLNELSQRNITGLSSFISGSAVDQSSEHQDNSLFYNRSPYYTNQKQPHFLQQLHPQQPPLYQGRY

41 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make foxi1-b using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here