Transcriptional repressor that down-regulates bmp4 signaling in both mesoderm and ectoderm. Regulates mesoderm patterning by repressing ventral mesoderm genes and promoting the expression of dorsolateral genes. Can also neuralize ectodermal cells directly. Inhibits neural crest migration. The transcription factors foxd1 and foxg1 mutually repress each other to pattern the forebrain (By similarity).

329 amino acids

MTLSSDMSDVLAEETDIDVVGEDDEPRAEEEEDEDLHGDLLPTSPQSSATKDPYKGTGGGGGRSALVKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQAPELVLREPGHFLPASAYSYGPYSCAYGIQLQPFHPHSALIAFQQQQQQARQQPPSLPPMAAPALMPPAAQDLSRTCTFYPHQLSPAALPPSLQSKSSSALARSTFSIESIIGGDLNPGQCNSPKAAGVPVISRALVTFSSSQAAAALGGTLQPGTVLTNH

35.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make foxd1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here