Transcriptional activator. Upon TGF-beta induction, forms a transcriptionally active complex with smad2 and smad4 called activin-responsive factor 2 (ARF2), which binds a site on the mix-B/mix.2 promoter called the activin response element (ARE). Binds to activated smads and the ARE with much higher affinity than foxh1/fast-1. Acts with foxh1/fast-1 to control the convergent extension movements of gastrulation.

344 amino acids

MSFGLHPWDVAFRPSPPHNLEKKVVPPGADREKSLPSPKEDSDGAREPDSTVDLRKKNKKKKNYQRYAKPPYSYLAMISLVIQNSPEKRLKLSQILQDISSLFPFFKGNYQGWKDSIRHNLSSNDCFRKVLKDPLKPQAKGNYWTVDVTRIPPDALKLQNTAVTRQDLFPLDLAPYILHGQPYRSLERLSANHTRGRTTPRMEPEVQIPVSDPAVSFPMILWNLPTSYSKCVAPNVVAPPSIHPLLLYSNFPSISIYNYLPPPYGSPVYSDRRDLLASGLHPQIPLTPKPPELKNAPSDFPPNKTVFDIPVYTGHPGFLASQSLFSPHLPTATPPLVGYRPSGL

38.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fast3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here