Plays a major role in protein secretion by helping the post-translocational extracellular folding of several secreted proteins.

Belongs to the PrsA family.

309 amino acids

MKYRLIGVGASLVVAVMLTGCQAKATTLVKSDAGQVTQAEVFKQIENQATTQQAVQELTLNKVLNQRYHVSQAEVTAKLKAFKRQAGANYHMILERNHVTEPRLKSQIKANLLMEKAVSAKYPVTKAQLKKARAAYMPMTTVQHIATTNEKQAQKIIAELNAGASFDSQVRKYQNNRQAHTTAGKLAQFDSYNQTLAPAIVQATAKLRVGHYVTKPVKTVMATADTKDKPTYEIINVVSRRSKTAAVTDDSGKQIDVTNYLREKIQQQRMMDKQTQVATIRSVFKAAHVKVVDAHFAPAFNDYLTTQNS

34.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make prsA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here