Transcription factor that confers fluconazole resistance in S.cerevisiae by activation of the PDR5 gene. Can also activate the transcription of S.cerevisiae genes involved in 4-nitroquinoline-N-oxide resistance.

Belongs to the bZIP family.

399 amino acids

MNFKTENSTTPNGDWSQSKAFTNSGSSFPVLNGTCELDQENLALSNSGQPESIFTQDSGLHGIDVAAPSDITDLNNQSGYQYNNNLAHDLYFTGSMEMPTTQHPYITNTNNHLSYSNSSEEFSPIGNNMSPDSTGGANSNNFTSGNKRKASNESFSPLSGHHYGTESGNNNNNNGTSRSSQSSSHKSRKKLLDEKDAALIARDDSELTEEELQMKRKAQNRAAQRAFRERKESKLKELEAKLLASEEERQKLLDELEQIKKQNISIATENEILKHNGMGNINNDVQIGNLSSYGRLQVDKFNFPKTQKDFIEHVLQGTNHQLKDENKDKVYNDNQGHKLLALGAVWDYLQIKAEEADLDFNSIDFNDVMEKLKGNEKCHGYGPAYPLELVNEAIESSLN

44.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FCR3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here