May play a role in axon growth and regeneration. May be involved in epidermal cell adhesion and epidermal structure and function (By similarity).

Belongs to the band 7/mec-2 family. Flotillin subfamily.

428 amino acids

MGNCYTVGPNEALVVSGGCCGSDGKTYTVGGWAWAWWLITDIQKITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVMTDNELLGYACEQFLGKTVTEIKSVILQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKSQTAAVQRDADIGVAEAERDAGIREAECKKEMMDIKFQADTKMADSKRELEMQKAAFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEKEILRTDKELIATVRRPAEAEAFKMEQLAEAKKIKKVLTAQAEAEKIKRIGEAEAGSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLGRTNEIVILSGDGGRVTGEVNRLLAELPVSVNALTGVDLSKIPLLQKMTNPQA

46.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make flot2a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here