About Products Protein Database Contact

Protein expression services for ubiX | Flavin prenyltransferase UbiX

Description
Flavin prenyltransferase that catalyzes the synthesis of the prenylated FMN cofactor (prenyl-FMN) for 4-hydroxy-3-polyprenylbenzoic acid decarboxylase UbiD. The prenyltransferase is metal-independent and links a dimethylallyl moiety from dimethylallyl monophosphate (DMAP) to the flavin N5 and C6 atoms of FMN (By similarity). Acts in concert with UbiD to perform the decarboxylation of 4-hydroxy-3-octaprenyl-benzoate, a step in the biosynthesis of coenzyme Q (PubMed:16923914, PubMed:17889824).
Family
Belongs to the UbiX/PAD1 family.
Species
Escherichia coli (strain K12)
Length
189 amino acids
Sequence
MKRLIVGISGASGAIYGVRLLQVLRDVTDIETHLVMSQAARQTLSLETDFSLREVQALADVTHDARDIAASISSGSFQTLGMVILPCSIKTLSGIVHSYTDGLLTRAADVVLKERRPLVLCVRETPLHLGHLRLMTQAAEIGAVIMPPVPAFYHRPQSLDDVINQTVNRVLDQFAITLPEDLFARWQGA
Mass
20.7 kDa
Simulated SDS-PAGE
Western blot of ubiX recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ubiX using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here