Flavin prenyltransferase that catalyzes the synthesis of the prenylated FMN cofactor (prenyl-FMN) for 4-hydroxy-3-polyprenylbenzoic acid decarboxylase UbiD. The prenyltransferase is metal-independent and links a dimethylallyl moiety from dimethylallyl monophosphate (DMAP) to the flavin N5 and C6 atoms of FMN.

Belongs to the UbiX/PAD1 family.

191 amino acids

MKVIKMIILAMTGASGVIYGERILKALRGAGVRIGLMITDTAREIIRYELGIEPGALEELADECFDASDFTTSINSGSSPFRAMVIAPCTMKTLSAIANGYAENSLTRAADVCLKERRDLVLVPRETPLRSVHLENMLRVSREGGIILPAMPGFYHKPASIEDMADFIAGKVLDVLGIENDLFRRWTGKDI

20.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ubiX using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here