Description
Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It enters the flap from the 5'-end and then tracks to cleave the flap base, leaving a nick for ligation. Also involved in the long patch base excision repair (LP-BER) pathway, by cleaving within the apurinic/apyrimidinic (AP) site-terminated flap. Acts as a genome stabilization factor that prevents flaps from equilibrating into structurs that lead to duplications and deletions. Also possesses 5'-3' exonuclease activity on nicked or gapped double-stranded DNA, and exhibits RNase H activity. Also involved in replication and repair of rDNA and in repairing mitochondrial DNA.
Family
Belongs to the XPG/RAD2 endonuclease family. FEN1 subfamily.
Species
Coprinopsis cinerea
Sequence
MGIKGLTGLLNEHAPNSIKEHDIKTLFGRKVAIDASMSIYQFLIAVRQRDGEMLTNDAGETTSHLMGFFYRTIRIVENGIKPAYVFDGKPPELKKGVLSKRFEKREEAKEEGEEAKEIGTAEDVDRFSRRTVKVTKQHNEECQKLLRLMSVPCVIAPSEAEAQCAELARGGKVYAAGSEDMDTLTFNAPILFRHLTFSEAKKQPISEINLEAALKGLDMDMSQFVDLCILLGCDYLEPIKGVGPKSALKLIREFGGLKEVVEHLREKAAARKAEAEEEDEEEAEEPAPTSDVEMPDDEDGEKDSDDEEEAERRKKAEAAKKKKAQEKAKSAKKGKGKGKGGIQIPDEWPWEEAKQIFLKPDVIPADQVELEWKNPDVEGLVQFLVTEKGFSEERVRKGAEKLTKFLNAKQQGRLDGFFTVKPKQAPPPAAKGKGAASKGTKRKGEDKAEGSGKKAKKK
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service