About Products Protein Database Contact

Protein expression services for FEN1 | Flap endonuclease 1

Description
Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It enters the flap from the 5'-end and then tracks to cleave the flap base, leaving a nick for ligation. Also involved in the long patch base excision repair (LP-BER) pathway, by cleaving within the apurinic/apyrimidinic (AP) site-terminated flap. Acts as a genome stabilization factor that prevents flaps from equilibrating into structurs that lead to duplications and deletions. Also possesses 5'-3' exonuclease activity on nicked or gapped double-stranded DNA, and exhibits RNase H activity. Also involved in replication and repair of rDNA and in repairing mitochondrial DNA.
Family
Belongs to the XPG/RAD2 endonuclease family. FEN1 subfamily.
Species
Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)
Length
458 amino acids
Sequence
MGIKGLTGLLNEHAPNSIKEHDIKTLFGRKVAIDASMSIYQFLIAVRQRDGEMLTNDAGETTSHLMGFFYRTIRIVENGIKPAYVFDGKPPELKKGVLSKRFEKREEAKEEGEEAKEIGTAEDVDRFSRRTVKVTKQHNEECQKLLRLMGVPCVIAPSEAEAQCAELARGGKVYAAGSEDMDTLTFNAPILFRHLTFSEAKKQPISEINLEAALKGLDMDMSQFVDLCILLGCDYLEPIKGVGPKSALKLIREFGGLKEVVEHLREKAAARKAEAEEEDEEEAEEPAPTSDVEMPDDEDGEKDSDDEEEAERRKKAEAAKKKKAQEKAKSAKKGKGKGKGGIQIPDEWPWEEAKQIFLKPDVIPADQVELEWKNPDVEGLVQFLVTEKGFSEERVRKGAEKLTKFLNAKQQGRLDGFFTVKPKQAPPPAAKGKGAASKGTKRKGEDKAEGSGKKAKKK
Mass
50.8 kDa
Simulated SDS-PAGE
Western blot of FEN1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make FEN1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here