Acts as an anti-CsrA protein, binds CsrA and prevents it from repressing translation of its target genes, one of which is flagellin. Binds to flagellin and participates in the assembly of the flagellum.

Belongs to the FliW family.

129 amino acids

MIFDVKAPILGFETIHKMHLQKIDEIFLRLNSAEDNSVVSFTLVNPFALRKYEFEVPTPLKILLELEGAKSVLVANIMVVQTPIELSTVNYLAPLIFNLDKQLMGQVVLDSKKYPHYHLRENILSHTHE

14.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fliW2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here