Makes up the pili which are long filamentous (less than 10 nm thick and up to 10 um long) polarly located appendages. They are required for social (S) motility.

Belongs to the N-Me-Phe pilin family.

220 amino acids

MRVSRFNPRNRGFTLIELMIVVAIIGILAAIAIPNFIKFQARSKQSEAKTNLKALYTAQKSFFSEKDRYSDFANEIGFAPERGNRYGYRVSAAAGDCEVRNAADLPVPAAGVPCISNDSFRFGANSAIDDPTPVVARFVPQGAAGWNTTLGVQPTIADCPNCNFFAGARGNADNEATFDDWVIAGFEGSGQVGPCSEAGNVASGTPYNTRNDVACDGAAQ

23.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pilA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here