Involved in the uptake of iron in complex with the siderophore anguibactin. Responsible for the translocation of ferric-anguibactin across the cytoplasmic membrane.

Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily.

314 amino acids

MTFRMILAFFTLCATSLFFGANQIEWSLLPTFNEKAWLPIIASRLPRLVALILTGSGLAMCGVILQHIVRNRFVEPGTTGSLDAAKLGILVSIVMLPSSDKLERMFFAVLFCFAAGLVYIAIIRKVKFSNTALVPVIGLMFGSVLSALAEFYAYQNNILQSMSGWLMGDFSKVVQEHYEIIFLILPITLLTYLYAHRFTVMGMGEDIASNLGISYAMTAALGLILVSITVAVTVVTVGAIHFVGLVIPNLVALKYGDHLKNTLPIVALGGASLLIFCDVISRVVLFPFEVPVGLTASAVGGVMFLAFLLKGAKA

33.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fatD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here