Acts as a global negative controlling element, employing Fe(2+) as a cofactor to bind the operator of the repressed genes.

Belongs to the Fur family.

156 amino acids

MLMENLEYDVLLEKFKKILREGGLKYTKQREVLLKTLYHSDTHYTPESLYMEIKQAEPDSNVGIATVYRTLNLLEEAEMVTSLSLDSAGKKYELSNKPHHDHMICKVCGKIIEFENPIIERQQSLIANEHHFKLTGHLMQLYGICSDCNHKTKVKI

18.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fur using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here