Fur acts as a repressor, employing Fe(2+) as a cofactor to bind the operator of the iron transport operon. It plays a role in the regulation of expression of the outer membrane protein fatA and synthesis of catechols which are intermediates in the biosynthesis of anguibactin.

Belongs to the Fur family.

149 amino acids

MSDNNQALKDAGLKVTLPRLKILEVLQQPECQHISAEELYKKLIDLGEEIGLATVYRVLNQFDDAGIVTRHHFEGGKSVFELSTQHHHDHLVCLDCGEVIEFSDEVIEQRQREIAEQYNVQLTNHSLYLYGKCADGSCKQNPNAHKSKR

17 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fur using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here