Plays a role in electron transfer. The fas operon encodes genes involved in cytokinin production and in host plant fasciation (leafy gall).

In the C-terminal section; belongs to the transketolase family.

304 amino acids

MKVVVNERRCFGSGQCVLVAPEVFEQSNDGTVTLLVDKPSPDNHSLVRAAARSCPATAIRFEENAMRQEPTEFSYDDLPALISRMRGDERHSFSSSSTMDVLWVLYDEIPNVSPESPDDDDRDRFLLSKGHGPMAYYAVLAAKGFLRPELLDTWATKNSPLGFAPDRTKISGVEMSGGSLGHGLPLAVGVAMGLRIQNRHAPRVFVLIGDGEFDEGSNHEAMAFAGRARLNQLTVIVLDNGTASMGWPHGIDKRFDGEGWDTININGADHEEIAAALNRDHNDRPLAVVATVTRQSARSSIQQR

33.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fas2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here