Description
Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the scaffold complex CFD1-NBP35. Electrons are transferred to DRE2 from NADPH via the FAD- and FMN-containing protein TAH18. TAH18-DRE2 are also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit RNR2.
Family
Belongs to the anamorsin family.
Species
Candida albicans (strain WO-1)
Sequence
MTSSINILLLLHPTVVTDAQLVEQIKSKIYQSHNNNNNNNGGTTTTTTGTVNINLNQQIIDRVTKGIIELPYDYYDEIIYINPNNESQYREIPISLMQLIYKLLKSNGKFKGDLPLDQNLDVLMTGFIIEEEEKEKEENNLEGELVNVWVKPIPVDEPVVTLLKKKTTTSNTTTKKKSLPLFKKLNKDEINNSDKDINNDNITNNNNNNNNNKRKLVETKLTYFSSDDENSSDGSVSENDDIDDDDELIDENDLLNFNNNNNNNTNGGSLLSDKLITPRKCDISLNGGKKRKKACKDCTCGLKELEELEVSNQQNLQDQILGKLAQSATLEAIKIEERLKQQQQQQQQQKVKVKFTEEDLSEIDFTVQGKTGGCGSCALGDAFRCDGCPYLGLPPFKPGEVVKLDGFGEDI
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service