Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.

Belongs to the NfuA family.

194 amino acids

MSAITITEAAQAYLAELLEKQSTPGIGIRIFITQPGTQYAETCIAYCKPGEEKVEDTAIALKDFTAWIDAVSEPFLEDAVVDYATDRMGGQLTIKAPNAKVPMVNEDSPITERINYYLQTEINPGLASHGGQVSLVDVVEDNIAVLRFGGGCQGCGMVDMTLKDGVEKTLIERIPELKGVRDVTDHSNKENAYY

21.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nfuA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here