About Products Protein Database Contact

Protein expression services for Fbxl17 | F-box/LRR-repeat protein 17

Description
Substrate-recognition component of the SCF(FBXL17) E3 ubiquitin ligase complex, a key component of a quality control pathway required to ensure functional dimerization of BTB domain-containing proteins (dimerization quality control, DQC). FBXL17 specifically recognizes and binds a conserved degron of non-consecutive residues present at the interface of BTB dimers of aberrant composition: aberrant BTB dimer are then ubiquitinated by the SCF(FBXL17) complex and degraded by the proteaseome (By similarity). The ability of the SCF(FBXL17) complex to eliminate compromised BTB dimers is required for the differentiation and survival of neural crest and neuronal cells (By similarity). The SCF(FBXL17) complex mediates ubiquitination and degradation of BACH1 (By similarity). The SCF(FBXL17) complex is also involved in the regulation of the hedgehog/smoothened (Hh) signaling pathway by mediating the ubiquitination and degradation of SUFU, allowing the release of GLI1 from SUFU for proper Hh signal transduction (PubMed:27234298). The SCF(FBXL17) complex mediates ubiquitination and degradation of PRMT1 (PubMed:28883095).
Family
Belongs to the FBXL17 family.
Species
Mus musculus
Length
701 amino acids
Sequence
MGHLLSKEPRNRPSQKRPRCCSWCRRRRPLLRLPRRALAKASPQPAAPRSRDCFFRGPCMLCFIVHSPGAPASAGLEEEPPLSPPPPPPRDGAYAAVSSQHLARRYAALAAEDCAAAARRFLLSSAAAAAAAASSPASCCKELGLAAAAAWEQQGRSLFLAGVGPVRFLGPLAAVQLFRAPPAPPPQAEPATALEMVCKRKGAGVPACTPCKQPRCGCGGCGGGGGGGGGPAGGGASPPRPPDAGCCQAPEQPPPPLCPAPASPASECAPIVAAAGDTVRAGGTAPSSAQQQPESGDADCQEPPENPCDCHREPPPEIPDINQLPPSILLKIFSNLSLNERCLSASLVCKYWRDLCLDFQFWKQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSLSDSGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSRCRELKDIHFGQCYKISDEGMIVIAKSCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSCKITDYALIAIGRYSVTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNELTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAATS
Mass
75.7 kDa
Simulated SDS-PAGE
Western blot of Fbxl17 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Fbxl17 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here