Involved in the synthesis of alkyl hydroxycinnamates in root waxes. Functions as a fatty alcohol:hydroxy cinnamoyl-CoA acyltransferase with apparent preference for caffeoyl-CoA.

Belongs to the plant acyltransferase family.

426 amino acids

MADSFELIVTRKEPVLVSPASETPKGLHYLSNLDQNIAIIVKTFYYFKSNSRSNEESYEVIKKSLSEVLVHYYPAAGRLTISPEGKIAVDCTGEGVVVVEAEANCGIEKIKKAISEIDQPETLEKLVYDVPGARNILEIPPVVVQVTNFKCGGFVLGLGMNHNMFDGIAAMEFLNSWAETARGLPLSVPPFLDRTLLRPRTPPKIEFPHNEFEDLEDISGTGKLYSDEKLVYKSFLFGPEKLERLKIMAETRSTTFQTLTGFLWRARCQALGLKPDQRIKLLFAADGRSRFVPELPKGYSGNGIVFTYCVTTAGEVTLNPLSHSVCLVKRAVEMVNDGFMRSAIDYFEVTRARPSLTATLLITSWAKLSFHTKDFGWGEPVVSGPVGLPEKEVILFLPCGSDTKSINVLLGLPGSAMKVFQGIMDI

47.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FACT using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here